PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G46600.1
Common NameF12A12.120, SCL30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 583aa    MW: 66629.3 Da    PI: 5.4836
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G46600.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS403.52e-1232095791374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  +++lL++cA+av+s d+++a + L++++e++s +gd++qRl  +f+eAL+ar+++   ++   + + ++s++++++ l+a+k f++++P+l ++++ta
  AT3G46600.1 209 MRNLLMQCAQAVASFDQRRAFEKLKEIREHSSRHGDATQRLGYHFAEALEARITG---TMTTPI-SATSSRTSMVDILKAYKGFVQACPTLIMCYFTA 302
                  579****************************************************...333223.333334569************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N++I e +++++++HiiDf+i +G+QWp+L+qaL++R+ gpp lR+Tg++ p+sg   +e++eetg+rL++f+++++vpfe+++ +ak++e+++l++L
  AT3G46600.1 303 NRTINELASKATTLHIIDFGILYGFQWPCLIQALSKRDIGPPLLRVTGIELPQSGfrPSERVEETGRRLKRFCDKFNVPFEYSF-IAKNWENITLDDL 399
                  ******************************************************9*****************************.7************ PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                   +++gE+++Vn++l+l++++de+vsl+s+rd+ Lkl+++++P+++v++e +  +ns+ Fl+rf eal ++s+lfd++e++l+++++ r+ vErel+ r
  AT3G46600.1 400 VINSGETTVVNCILRLQYTPDETVSLNSPRDTALKLFRDINPDLFVFAEINGTYNSPFFLTRFREALFHCSSLFDMYETTLSEDDNCRTLVERELIIR 497
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++++v+aceg+er++r et+++W+ r+ +aGF+p++ls++++k+ k ++++ + + + ++++++++++gWk+r L++vS+W+
  AT3G46600.1 498 DAMSVIACEGSERFARPETYKQWQVRILRAGFRPAKLSKQIVKDGKEIVKERYHKDFVIDNDNHWMFQGWKGRVLYAVSCWK 579
                  *****************************************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.988183559IPR005202Transcription factor GRAS
PfamPF035147.0E-121209579IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MDAILPVPVD GFRFDTGSGS CCKPRNNLES GTTNRFTCFN ESESQSNPSP TESKVCSDYL  60
PVFKYINDML MEEDLEGQSC MLEDSLALQA AERSFFEVLQ DQTPISGDLE DGSLGNFSSI  120
TSLHQPEVSE ESTRRYRHRD DDEDDDLESG RKSKLPAIST VDELAEKFEE VLLVCQKNDQ  180
GEATEKKTRH VKGSSNRYKQ QKSDQPVDMR NLLMQCAQAV ASFDQRRAFE KLKEIREHSS  240
RHGDATQRLG YHFAEALEAR ITGTMTTPIS ATSSRTSMVD ILKAYKGFVQ ACPTLIMCYF  300
TANRTINELA SKATTLHIID FGILYGFQWP CLIQALSKRD IGPPLLRVTG IELPQSGFRP  360
SERVEETGRR LKRFCDKFNV PFEYSFIAKN WENITLDDLV INSGETTVVN CILRLQYTPD  420
ETVSLNSPRD TALKLFRDIN PDLFVFAEIN GTYNSPFFLT RFREALFHCS SLFDMYETTL  480
SEDDNCRTLV ERELIIRDAM SVIACEGSER FARPETYKQW QVRILRAGFR PAKLSKQIVK  540
DGKEIVKERY HKDFVIDNDN HWMFQGWKGR VLYAVSCWKP AKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-442135798375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.5950.0bud| flower| leaf| root| seed| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306927350.0
Genevisible252483_at0.0
Expression AtlasAT3G46600-
AtGenExpressAT3G46600-
ATTED-IIAT3G46600-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves, sepals, stamen and pistil, and in the quiescent center of root meristem. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G46600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G46600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2264190.0AK226419.1 Arabidopsis thaliana mRNA for scarecrow-like protein, complete cds, clone: RAFL06-09-N12.
GenBankAL1333140.0AL133314.1 Arabidopsis thaliana DNA chromosome 3, BAC clone F12A12.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190244.10.0scarecrow-like protein 30
SwissprotQ9SNB80.0SCL30_ARATH; Scarecrow-like protein 30
TrEMBLD7LN250.0D7LN25_ARALL; Scarecrow transcription factor family protein
STRINGAT3G46600.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36462561
Representative plantOGRP26615129
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Klok EJ, et al.
    Expression profile analysis of the low-oxygen response in Arabidopsis root cultures.
    Plant Cell, 2002. 14(10): p. 2481-94
    [PMID:12368499]
  3. Bolle C
    The role of GRAS proteins in plant signal transduction and development.
    Planta, 2004. 218(5): p. 683-92
    [PMID:14760535]
  4. Lorkovic ZJ,Lopato S,Pexa M,Lehner R,Barta A
    Interactions of Arabidopsis RS domain containing cyclophilins with SR proteins and U1 and U11 small nuclear ribonucleoprotein-specific proteins suggest their involvement in pre-mRNA Splicing.
    J. Biol. Chem., 2004. 279(32): p. 33890-8
    [PMID:15166240]
  5. Kasukabe Y, et al.
    Overexpression of spermidine synthase enhances tolerance to multiple environmental stresses and up-regulates the expression of various stress-regulated genes in transgenic Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(6): p. 712-22
    [PMID:15215506]
  6. Tian C,Wan P,Sun S,Li J,Chen M
    Genome-wide analysis of the GRAS gene family in rice and Arabidopsis.
    Plant Mol. Biol., 2004. 54(4): p. 519-32
    [PMID:15316287]
  7. Gao MJ,Parkin I,Lydiate D,Hannoufa A
    An auxin-responsive SCARECROW-like transcriptional activator interacts with histone deacetylase.
    Plant Mol. Biol., 2004. 55(3): p. 417-31
    [PMID:15604690]
  8. Lorkovic ZJ,Lehner R,Forstner C,Barta A
    Evolutionary conservation of minor U12-type spliceosome between plants and humans.
    RNA, 2005. 11(7): p. 1095-107
    [PMID:15987817]
  9. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  10. Lee MH, et al.
    Large-scale analysis of the GRAS gene family in Arabidopsis thaliana.
    Plant Mol. Biol., 2008. 67(6): p. 659-70
    [PMID:18500650]
  11. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]